| Edit |   |
| Antigenic Specificity | TEKT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEKT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEKT3. This antibody reacts with rat. The TEKT3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ. |
| Other Names | FLJ32828, tektin 3, tektin-3, testicular microtubules-related protein |
| Gene, Accession # | TEKT3, Gene ID: 64518, Accession: Q4V8G8 |
| Catalog # | NBP1-74181 |
| Price | |
| Order / More Info | TEKT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |