| Edit |   |
| Antigenic Specificity | TEDC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEDC2. This antibody reacts with human. The TEDC2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human C16orf59 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CSLLRLRMREELSAAPMDWMQEYRCLLTLEGLQAMVGQCLHRLQELRAAV AEQPPRPCPVGRPPGASPSCGGRAEPAWSPQLLVYSST |
| Other Names | chromosome 16 open reading frame 59, FLJ13909, hypothetical protein LOC80178 |
| Gene, Accession # | C16ORF59, Gene ID: 80178 |
| Catalog # | NBP2-14383 |
| Price | |
| Order / More Info | TEDC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |