| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAPSS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAPSS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAPSS1. This antibody reacts with human. The PAPSS1 Antibody has been validated for the following applications: Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PAPSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINKVDMQWVQVL AE |
|---|
| Other Names | 3'-phosphoadenosine 5'-phosphosulfate synthase 1, ATPSK1SK 1, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1, EC 2.7.1.25, PAPS synthase 1, PAPSS 1, PAPSS3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1, SK1, Sulfurylase kinase 1 |
|---|
| Gene, Accession # | PAPSS1, Gene ID: 9061 |
|---|
| Catalog # | NBP2-13730 |
|---|
| Price | |
|---|
| Order / More Info | PAPSS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|