| 产品详情 |
| Edit |   |
| Antigenic Specificity | GKAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GKAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GKAP1. This antibody reacts with human. The GKAP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GKAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQALVLKDG |
| Other Names | cGMP-dependent protein kinase-anchoring protein of 42 kDa, FKSG21, FLJ25469, G kinase anchoring protein 1, G kinase-anchoring protein 1, GKAP42cGMP-dependent protein kinase anchoring protein 42kDa, protein kinase anchoring protein GKAP42 |
| Gene, Accession # | GKAP1, Gene ID: 80318 |
| Catalog # | NBP1-84669 |
| Price | |
| Order / More Info | GKAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|