| 产品详情 |
| Edit |   |
| Antigenic Specificity | Girdin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Girdin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Girdin. This antibody reacts with human. The Girdin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Girdin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS |
| Other Names | Akt phosphorylation enhancer, APEGIRDIN, coiled-coil domain containing 88A, Coiled-coil domain-containing protein 88A, G alpha-interacting vesicle-associated protein, G{alpha}-interacting vesicle-associated protein, Girders of actin filament, girdin, GIVFLJ10392, GRDNAKT-phosphorylation enhancer, HKRP1, HkRP1Galpha-interacting vesicle-associated protein, Hook-related protein 1, KIAA1212DKFZp686D0630 |
| Gene, Accession # | CCDC88A, Gene ID: 55704, Accession: Q3V6T2, SwissProt: Q3V6T2 |
| Catalog # | NBP2-38387 |
| Price | |
| Order / More Info | Girdin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|