| 产品详情 |
| Edit |   |
| Antigenic Specificity | NEK1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NEK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEK1. This antibody reacts with human. The NEK1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NEK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR |
| Other Names | DKFZp686D06121, DKFZp686K12169, EC 2.7.11, EC 2.7.11.1, KIAA1901MGC138800, Never in mitosis A-related kinase 1, NIMA (never in mitosis gene a)-related kinase 1, NimA-related protein kinase 1, NY-REN-55, protein-serine/threonine kinase, Renal carcinoma antigen NY-REN-55, serine/threonine-protein kinase Nek1, SRPS2 |
| Gene, Accession # | NEK1, Gene ID: 4750 |
| Catalog # | NBP1-82883 |
| Price | |
| Order / More Info | NEK1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|