| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEDP1/SENP8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEDP1/SENP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEDP1/SENP8. This antibody reacts with human. The NEDP1/SENP8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NEDP1/SENP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAK |
|---|
| Other Names | DEN1deneddylase-1, deneddylase 1, Deneddylase-1, EC 3.4.22.-, HsT17512, NEDD8-specific protease 1, NEDP1NEDD8 specific-protease cysteine 2, Protease, cysteine 2, protease, cysteine, 2 (NEDD8 specific), PRSC2, Sentrin/SUMO-specific protease SENP8, sentrin-specific protease 8, SUMO sentrin specific protease family member 8, SUMO/sentrin specific peptidase family member 8, SUMO/sentrin specific protease family member 8 |
|---|
| Gene, Accession # | SENP8, Gene ID: 123228 |
|---|
| Catalog # | NBP1-85259 |
|---|
| Price | |
|---|
| Order / More Info | NEDP1/SENP8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|