| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEDD4L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEDD4L Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEDD4L. This antibody reacts with human. The NEDD4L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NEDD4L(neural precursor cell expressed, developmentally down-regulated 4-like) The peptide sequence was selected from the middle region of NEDD4L. Peptide sequence TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPK |
|---|
| Other Names | E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed, developmentally down-regulated gene 4-like, RSP5ubiquitin-protein ligase Rsp5 |
|---|
| Gene, Accession # | NEDD4L, Gene ID: 23327, Accession: Q96PU5-5, SwissProt: Q96PU5-5 |
|---|
| Catalog # | NBP1-54974 |
|---|
| Price | |
|---|
| Order / More Info | NEDD4L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|