| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NEDD4L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NEDD4L Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEDD4L. This antibody reacts with human. The NEDD4L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NEDD4L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEM |
|---|
| Other Names | E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed, developmentally down-regulated gene 4-like, RSP5ubiquitin-protein ligase Rsp5 |
|---|
| Gene, Accession # | NEDD4L, Gene ID: 23327 |
|---|
| Catalog # | NBP1-81508 |
|---|
| Price | |
|---|
| Order / More Info | NEDD4L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|