| 产品详情 |
| Edit |   |
| Antigenic Specificity | NEDD9/CASL/HEF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NEDD9/CASL/HEF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NEDD9/CASL/HEF1. This antibody reacts with human. The NEDD9/CASL/HEF1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human NEDD9/CASL/HEF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA |
| Other Names | Cas scaffolding protein family member 2, CAS2, CasL, CAS-LCASS2cas-like docking, CASLdJ49G10.2, CRK-associated substrate-related protein, dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)), dJ761I2.1, dJ761I2.1 (enhancer of filamentation (HEF1)), enhancer of filamentation 1, hEF1, HEF1Crk-associated substrate related, NEDD-9, Neural precursor cell expressed developmentally down-regulated protein 9, neural precursor cell expressed, developmentally down-regulated 9, p105, Renal carcinoma antigen NY-REN-12 |
| Gene, Accession # | NEDD9, Gene ID: 4739 |
| Catalog # | NBP2-55071 |
| Price | |
| Order / More Info | NEDD9/CASL/HEF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|