| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lysyl Oxidase Homolog 2/LOXL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lysyl Oxidase Homolog 2/LOXL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lysyl Oxidase Homolog 2/LOXL2. This antibody reacts with human. The Lysyl Oxidase Homolog 2/LOXL2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Lysyl Oxidase Homolog 2/LOXL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI |
|---|
| Other Names | EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14 |
|---|
| Gene, Accession # | LOXL2, Gene ID: 4017 |
|---|
| Catalog # | NBP2-55314 |
|---|
| Price | |
|---|
| Order / More Info | Lysyl Oxidase Homolog 2/LOXL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|