| 产品详情 |
| Edit |   |
| Antigenic Specificity | Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C. This antibody reacts with human. The Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQ |
| Other Names | [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, EC 3.1.3, EC 3.1.3.43, MGC119646, PDH, PDP 1, PDPC, PDPC 1, PDPFLJ32517, PPM2CFLJ56179, Protein phosphatase 2C, protein phosphatase 2C, magnesium-dependent, catalytic subunit, pyruvate dehydrogenase (Lipoamide) phosphatase-phosphatase, Pyruvate dehydrogenase phosphatase catalytic subunit 1, pyruvate dehyrogenase phosphatase catalytic subunit 1 |
| Gene, Accession # | PDP1, Gene ID: 54704 |
| Catalog # | NBP1-87309 |
| Price | |
| Order / More Info | Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|