| 产品详情 |
| Edit |   |
| Antigenic Specificity | Pyruvate Dehydrogenase E1 beta subunit |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Pyruvate Dehydrogenase E1 beta subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pyruvate Dehydrogenase E1 beta subunit. This antibody reacts with human. The Pyruvate Dehydrogenase E1 beta subunit Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Pyruvate Dehydrogenase E1 beta subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE |
| Other Names | DKFZp564K0164, mitochondrial, pyruvate dehydrogenase (lipoamide) beta, pyruvate dehydrogenase, E1 beta polypeptide |
| Gene, Accession # | PDHB, Gene ID: 5162, Accession: P11177, SwissProt: P11177 |
| Catalog # | NBP2-38327 |
| Price | |
| Order / More Info | Pyruvate Dehydrogenase E1 beta subunit Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|