| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | gamma Sarcoglycan |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The gamma Sarcoglycan Antibody from Novus Biologicals is a rabbit polyclonal antibody to gamma Sarcoglycan. This antibody reacts with human, mouse. The gamma Sarcoglycan Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Frozen. |
|---|
| Immunogen | Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS. |
|---|
| Other Names | 35 kDa dystrophin-associated glycoprotein, 35DAG, A4, DAGA4,35kD dystrophin-associated glycoprotein, DMDA, DMDA1, gamma sarcoglycan, gamma-sarcoglycan, Gamma-SG, MAM, MGC130048, sarcoglycan, gamma (35kD dystrophin-associated glycoprotein), sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein), SCARMD2, SCG3LGMD2C, TYPE |
|---|
| Gene, Accession # | SGCG, Gene ID: 6445, Accession: Q13326, SwissProt: Q13326 |
|---|
| Catalog # | NBP1-59744 |
|---|
| Price | |
|---|
| Order / More Info | gamma Sarcoglycan Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29271299 |
|---|
| 产品资料 |
|
|