| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAB1. This antibody reacts with human. The TAB1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TAB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ |
|---|
| Other Names | MAP3K7IP13'-Tab1, MGC57664, mitogen-activated protein kinase kinase kinase 7 interacting protein 1, Mitogen-activated protein kinase kinase kinase 7-interacting protein 1, TAK1-binding protein 1, TGF-beta activated kinase 1/MAP3K7 binding protein 1, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1, TGF-beta-activated kinase 1-binding protein 1, transforming growth factor beta-activated kinase-binding protein 1 |
|---|
| Gene, Accession # | TAB1, Gene ID: 10454, Accession: Q15750, SwissProt: Q15750 |
|---|
| Catalog # | NBP2-38819 |
|---|
| Price | |
|---|
| Order / More Info | TAB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|