| Edit |   |
|---|
| Antigenic Specificity | Myosin IF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Myosin IF Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin IF. This antibody reacts with human. The Myosin IF Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Myosin IF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG |
|---|
| Other Names | myosin IF, myosin-ID, myosin-Ie, myosin-If |
|---|
| Gene, Accession # | MYO1F, Gene ID: 4542, Accession: O00160, SwissProt: O00160 |
|---|
| Catalog # | NBP2-31598 |
|---|
| Price | |
|---|
| Order / More Info | Myosin IF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|