| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Myosin Heavy Chain 3 |
|---|
| Clone | 3H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Myosin Heavy Chain 3 Antibody (3H3) from Novus Biologicals is a mouse monoclonal antibody to Myosin Heavy Chain 3. This antibody reacts with human. The Myosin Heavy Chain 3 Antibody (3H3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MYH3 (NP_002461.1, 2 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP |
|---|
| Other Names | HEMHC, Muscle embryonic myosin heavy chain, MYHC-EMB, MYHSE1, Myosin heavy chain, fast skeletal muscle, embryonic, myosin, heavy chain 3, skeletal muscle, embryonic, myosin, heavy polypeptide 3, skeletal muscle, embryonic, myosin, skeletal, heavy chain, embryonic 1, myosin-3, SMHCEMyosin heavy chain 3 |
|---|
| Gene, Accession # | MYH3, Gene ID: 4621, Accession: NP_002461, SwissProt: NP_002461 |
|---|
| Catalog # | H00004621-M06 |
|---|
| Price | |
|---|
| Order / More Info | Myosin Heavy Chain 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|