| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DAP12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DAP12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DAP12. This antibody reacts with human. The DAP12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DAP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK |
|---|
| Other Names | DAP12PLOSL, DNAX-activation protein 12, KARAPPLO-SL, KAR-associated protein, killer activating receptor associated protein, Killer-activating receptor-associated protein, TYRO protein tyrosine kinase binding protein, TYRO protein tyrosine kinase-binding protein |
|---|
| Gene, Accession # | TYROBP, Gene ID: 7305 |
|---|
| Catalog # | NBP1-85313 |
|---|
| Price | |
|---|
| Order / More Info | DAP12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25711697 |
|---|
| 产品资料 |
|
|