| Edit |   |
|---|
| Antigenic Specificity | QTRTD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The QTRTD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to QTRTD1. This antibody reacts with human. The QTRTD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to QTRTD1(queuine tRNA-ribosyltransferase domain containing 1) The peptide sequence was selected from the N terminal of QTRTD1. Peptide sequence YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI. |
|---|
| Other Names | EC 2.4.2.29, FLJ12960, queuine tRNA-ribosyltransferase domain containing 1, Queuine tRNA-ribosyltransferase domain-containing protein 1, queuine tRNA-ribosyltransferase subunit QTRTD1 |
|---|
| Gene, Accession # | QTRTD1, Gene ID: 79691, Accession: Q9H974, SwissProt: Q9H974 |
|---|
| Catalog # | NBP1-52948-20ul |
|---|
| Price | |
|---|
| Order / More Info | QTRTD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|