| Edit |   |
| Antigenic Specificity | QTRTD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The QTRTD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to QTRTD1. This antibody reacts with human. The QTRTD1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: QTRTD1 |
| Immunogen | Synthetic peptides corresponding to QTRTD1(queuine tRNA-ribosyltransferase domain containing 1) The peptide sequence was selected from the N terminal of QTRTD1. Peptide sequence YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI. |
| Other Names | EC 2.4.2.29, FLJ12960, queuine tRNA-ribosyltransferase domain containing 1, Queuine tRNA-ribosyltransferase domain-containing protein 1, queuine tRNA-ribosyltransferase subunit QTRTD1 |
| Gene, Accession # | QTRTD1, Gene ID: 79691, Accession: Q9H974, SwissProt: Q9H974 |
| Catalog # | NBP1-52948 |
| Price | |
| Order / More Info | QTRTD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |