| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DARPP-32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DARPP-32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DARPP-32. This antibody reacts with human, mouse. The DARPP-32 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse DARPP-32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE |
|---|
| Other Names | protein phosphatase 1, regulatory (inhibitor) subunit 1B, regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32) |
|---|
| Gene, Accession # | PPP1R1B, Gene ID: 84152, Accession: Q9UD71, SwissProt: Q9UD71 |
|---|
| Catalog # | NBP2-33534 |
|---|
| Price | |
|---|
| Order / More Info | DARPP-32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|