| Edit |   |
| Antigenic Specificity | DAP Kinase 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DAP Kinase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DAP Kinase 1. This antibody reacts with human. The DAP Kinase 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to DAPK1(death-associated protein kinase 1) The peptide sequence was selected from the N terminal of DAPK1. Peptide sequence MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK. |
| Other Names | DAPKDAP kinase 1, death-associated protein kinase 1, DKFZp781I035, EC 2.7.11, EC 2.7.11.1 |
| Gene, Accession # | DAPK1, Gene ID: 1612, Accession: P53355, SwissProt: P53355 |
| Catalog # | NBP1-59001 |
| Price | |
| Order / More Info | DAP Kinase 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |