| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITF46 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ITF46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITF46. This antibody reacts with human. The ITF46 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ITF46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEF |
|---|
| Other Names | C11orf2UPF0360, C11orf60, chromosome 11 open reading frame 60, FLJ21827, intraflagellar transport 46 homolog (Chlamydomonas), intraflagellar transport protein 46 homolog, intraflagellar transport protein IFT46 |
|---|
| Gene, Accession # | IFT46, Gene ID: 56912 |
|---|
| Catalog # | NBP2-55728 |
|---|
| Price | |
|---|
| Order / More Info | ITF46 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|