| 产品详情 |
| Edit |   |
| Antigenic Specificity | ITCH/AIP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ITCH/AIP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITCH/AIP4. This antibody reacts with human. The ITCH/AIP4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ITCH/AIP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS |
| Other Names | AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase homolog (mouse), itchy homolog E3 ubiquitin protein ligase, NAPP1E3 ubiquitin-protein ligase Itchy homolog, NFE2-associated polypeptide 1, ubiquitin protein ligase ITCH |
| Gene, Accession # | ITCH, Gene ID: 83737 |
| Catalog # | NBP2-55083 |
| Price | |
| Order / More Info | ITCH/AIP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|