| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APBA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APBA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APBA1. This antibody reacts with human. The APBA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human APBA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE |
|---|
| Other Names | Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA |
|---|
| Gene, Accession # | APBA1, Gene ID: 320 |
|---|
| Catalog # | NBP2-56155 |
|---|
| Price | |
|---|
| Order / More Info | APBA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|