| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP3B1 |
|---|
| Clone | 3B4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP3B1 Antibody (3B4) from Novus Biologicals is a mouse monoclonal antibody to AP3B1. This antibody reacts with human. The AP3B1 Antibody (3B4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | AP3B1 (NP_003655 995 a.a. - 1094 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG |
|---|
| Other Names | Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit |
|---|
| Gene, Accession # | AP3B1, Gene ID: 8546, Accession: NP_003655, SwissProt: NP_003655 |
|---|
| Catalog # | H00008546-M06 |
|---|
| Price | |
|---|
| Order / More Info | AP3B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|