| Edit |   |
| Antigenic Specificity | AP1AR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AP1AR Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP1AR. This antibody reacts with human. The AP1AR Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AP1AR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED |
| Other Names | 2C18, adaptor-related protein complex 1 associated regulatory protein, gamma-BAR, GBAR |
| Gene, Accession # | AP1AR, Gene ID: 55435 |
| Catalog # | NBP2-58664 |
| Price | |
| Order / More Info | AP1AR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |