| Edit |   |
|---|
| Antigenic Specificity | AP1AR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP1AR Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP1AR. This antibody reacts with human. The AP1AR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AP1AR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE |
|---|
| Other Names | 2C18, adaptor-related protein complex 1 associated regulatory protein, gamma-BAR, GBAR |
|---|
| Gene, Accession # | AP1AR, Gene ID: 55435, Accession: Q63HQ0, SwissProt: Q63HQ0 |
|---|
| Catalog # | NBP1-90879 |
|---|
| Price | |
|---|
| Order / More Info | AP1AR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|