| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKR1CL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKR1CL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKR1CL2. This antibody reacts with human. The AKR1CL2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AKR1CL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQI |
|---|
| Other Names | AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein |
|---|
| Gene, Accession # | AKR1E2, Gene ID: 83592 |
|---|
| Catalog # | NBP2-55163 |
|---|
| Price | |
|---|
| Order / More Info | AKR1CL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|