| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKAP9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKAP9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAP9. This antibody reacts with human. The AKAP9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human AKAP9. Peptide sequence MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS. |
|---|
| Other Names | A kinase (PRKA) anchor protein (yotiao) 9, AKAP 350, AKAP 450, AKAP350A-kinase anchor protein 450 kDa, AKAP450A-kinase anchor protein 350 kDa, AKAP-9, Centrosome- and Golgi-localized PKN-associated protein, CG-NAPAKAP 120-like protein, hgAKAP 350, HYPERION, KIAA0803A-kinase anchor protein 9, MU-RMS-40.16A, PRKA9AKAP9-BRAF fusion protein, Protein hyperion, protein kinase A anchoring protein 9, Protein kinase A-anchoring protein 9, Protein yotiao, YOTIAOkinase N-associated protein |
|---|
| Gene, Accession # | AKAP9, Gene ID: 10142, Accession: AAH15533, SwissProt: AAH15533 |
|---|
| Catalog # | NBP1-80308 |
|---|
| Price | |
|---|
| Order / More Info | AKAP9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|