| Edit |   |
|---|
| Antigenic Specificity | beta-Synuclein |
|---|
| Clone | 4F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-Synuclein Antibody (4F11) from Novus Biologicals is a mouse monoclonal antibody to beta-Synuclein. This antibody reacts with human. The beta-Synuclein Antibody (4F11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SNCB (NP_001001502.1, 1 a.a. - 65 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASH |
|---|
| Other Names | beta-synuclein, synuclein, beta |
|---|
| Gene, Accession # | SNCB, Gene ID: 6620, Accession: NP_001001502, SwissProt: NP_001001502 |
|---|
| Catalog # | H00006620-M16 |
|---|
| Price | |
|---|
| Order / More Info | beta-Synuclein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|