| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta Sarcoglycan |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 28284983). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta Sarcoglycan Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Sarcoglycan. This antibody reacts with human, mouse. The beta Sarcoglycan Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human beta Sarcoglycan antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH |
|---|
| Other Names | 43 kDa dystrophin-associated glycoprotein, 43DAG, A3bbeta-SG, beta-sarcoglycan, beta-sarcoglycan(43kD dystrophin-associated glycoprotein), Beta-SG, LGMD2E, limb girdle muscular dystrophy 2E (non-linked families), sarcoglycan, beta (43kD dystrophin-associated glycoprotein), sarcoglycan, beta (43kDa dystrophin-associated glycoprotein), SGC |
|---|
| Gene, Accession # | SGCB, Gene ID: 6443, Accession: Q16585, SwissProt: Q16585 |
|---|
| Catalog # | NBP1-90300 |
|---|
| Price | |
|---|
| Order / More Info | beta Sarcoglycan Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26214262, 27669143, 28284983, 29712757 |
|---|
| 产品资料 |
|
|