| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4. This antibody reacts with human. The Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to B3GNT4(UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4) The peptide sequence was selected from the N terminal of B3GNT4. Peptide sequence MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR. |
|---|
| Other Names | B3GN-T4, beta-1,3-Gn-T4, Beta-1,3-N-acetylglucosaminyltransferase 4, beta-1,3-N-acetylglucosaminyltransferase bGn-T4, beta3Gn-T4, BGnT-4, EC 2.4.1.-, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
|---|
| Gene, Accession # | B3GNT4, Gene ID: 79369, Accession: Q9C0J1, SwissProt: Q9C0J1 |
|---|
| Catalog # | NBP1-55107-20ul |
|---|
| Price | |
|---|
| Order / More Info | Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|