| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4. This antibody reacts with human. The Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
|---|
| Other Names | B3GN-T4, beta-1,3-Gn-T4, Beta-1,3-N-acetylglucosaminyltransferase 4, beta-1,3-N-acetylglucosaminyltransferase bGn-T4, beta3Gn-T4, BGnT-4, EC 2.4.1.-, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
|---|
| Gene, Accession # | B3GNT4, Gene ID: 79369, Accession: Q9C0J1, SwissProt: Q9C0J1 |
|---|
| Catalog # | NBP2-30927 |
|---|
| Price | |
|---|
| Order / More Info | Beta-1,3-N-Acetylglucosaminyltransferase 4/B3GNT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|