| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM101B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM101B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM101B. This antibody reacts with human. The FAM101B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FAM101B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC |
|---|
| Other Names | CFM1, FAM101B, Family With Sequence Similarity 101, Member B, Filamin-Interacting Protein FAM101B, Protein FAM101B, Refilin B, RefilinB, Refilin-B, Regulator Of Filamin Protein B, RFLNB |
|---|
| Gene, Accession # | FAM101B, Gene ID: 359845, Accession: Q8N5W9, SwissProt: Q8N5W9 |
|---|
| Catalog # | NBP2-30519 |
|---|
| Price | |
|---|
| Order / More Info | FAM101B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|