| Edit |   |
|---|
| Antigenic Specificity | FAM90A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM90A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM90A1. This antibody reacts with human. The FAM90A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FAM90A1(family with sequence similarity 90, member A1) The peptide sequence was selected from the N terminal of FAM90A1. Peptide sequence PDEEDPRLKCKNCEAFGHTARSTRCPMKCWKAALVPPNFGEKEGKENLKP. |
|---|
| Other Names | family with sequence similarity 90, member A1, FLJ10408, hypothetical protein LOC55138 |
|---|
| Gene, Accession # | FAM90A1, Gene ID: 55138, Accession: Q86YD7, SwissProt: Q86YD7 |
|---|
| Catalog # | NBP1-56875 |
|---|
| Price | |
|---|
| Order / More Info | FAM90A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|