| Edit |   |
|---|
| Antigenic Specificity | FAM82A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM82A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM82A. This antibody reacts with human. The FAM82A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM82A. Peptide sequence: RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP |
|---|
| Other Names | family with sequence similarity 82, member A1, member A, UNQ9371/PRO34163 |
|---|
| Gene, Accession # | RMDN2, Gene ID: 151393, Accession: NP_653314, SwissProt: NP_653314 |
|---|
| Catalog # | NBP1-79510-20ul |
|---|
| Price | |
|---|
| Order / More Info | FAM82A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|