| Edit |   |
|---|
| Antigenic Specificity | FAM81A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM81A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM81A. This antibody reacts with human. The FAM81A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human FAM81AThe immunogen for this antibody is FAM81A. Peptide sequence GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT. |
|---|
| Other Names | family with sequence similarity 81, member A, hypothetical protein LOC145773, MGC26690 |
|---|
| Gene, Accession # | FAM81A, Gene ID: 145773, Accession: NP_689663, SwissProt: NP_689663 |
|---|
| Catalog # | NBP1-79521 |
|---|
| Price | |
|---|
| Order / More Info | FAM81A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|