| Edit |   |
|---|
| Antigenic Specificity | Serine/threonine-protein kinase NIM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Serine/threonine-protein kinase NIM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serine/threonine-protein kinase NIM1. This antibody reacts with human. The Serine/threonine-protein kinase NIM1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MGC42105(hypothetical protein MGC42105) The peptide sequence was selected from the middle region of MGC42105. Peptide sequence LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQI. |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, NIM1, serine/threonine-protein kinase NIM1 |
|---|
| Gene, Accession # | NIM1, Gene ID: 167359, Accession: Q8IY84, SwissProt: Q8IY84 |
|---|
| Catalog # | NBP1-56740 |
|---|
| Price | |
|---|
| Order / More Info | Serine/threonine-protein kinase NIM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|