| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NMDARA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NMDARA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMDARA1. This antibody reacts with human. The NMDARA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NMDARA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK |
|---|
| Other Names | glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3 |
|---|
| Gene, Accession # | GRINA, Gene ID: 2907 |
|---|
| Catalog # | NBP1-92187 |
|---|
| Price | |
|---|
| Order / More Info | NMDARA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|