| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EphA6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EphA6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EphA6. This antibody reacts with human. The EphA6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EphA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPH PVPGGGSLPPRIPAGRPVMIVVEYMENGSLDS |
|---|
| Other Names | DKFZp434C1418, EC 2.7.10, EC 2.7.10.1, EHK2, EHK-2, EPA6, EPH homology kinase 2, EPH receptor A6, ephrin receptor EphA6, ephrin type-A receptor 6, FLJ35246, PRO57066 |
|---|
| Gene, Accession # | EPHA6, Gene ID: 285220 |
|---|
| Catalog # | NBP2-13964 |
|---|
| Price | |
|---|
| Order / More Info | EphA6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|