| Edit |   |
|---|
| Antigenic Specificity | MARCH4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin: HIER pH 6 retrieval method is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCH4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCH4. This antibody reacts with human. The MARCH4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MARCH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP |
|---|
| Other Names | EC 6.3.2.-, KIAA1399E3 ubiquitin-protein ligase MARCH4, MARCH-IVMGC104908, membrane-associated ring finger (C3HC4) 4, Membrane-associated RING finger protein 4, Membrane-associated RING-CH protein IV, RNF174RING finger protein 174 |
|---|
| Gene, Accession # | MARCH4, Gene ID: 57574, Accession: Q9P2E8, SwissProt: Q9P2E8 |
|---|
| Catalog # | NBP1-91639 |
|---|
| Price | |
|---|
| Order / More Info | MARCH4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|