| 产品详情 |
| Edit |   |
| Antigenic Specificity | MARCH3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MARCH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCH3. This antibody reacts with human. The MARCH3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MARCH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV |
| Other Names | EC 6.3.2, EC 6.3.2.-, MARCH-IIIFLJ20096, membrane-associated ring finger (C3HC4) 3, Membrane-associated RING finger protein 3, Membrane-associated RING-CH protein III, MGC48332, RING finger protein 173, RNF173E3 ubiquitin-protein ligase MARCH3 |
| Gene, Accession # | MARCH3, Gene ID: 115123, Accession: Q86UD3, SwissProt: Q86UD3 |
| Catalog # | NBP1-81260 |
| Price | |
| Order / More Info | MARCH3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|