| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MARCH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin: HIER pH 6 retrieval method is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARCH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARCH1. This antibody reacts with human. The MARCH1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MARCH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG |
|---|
| Other Names | E3 ubiquitin-protein ligase MARCH1, EC 6.3.2, EC 6.3.2.-, MARCH-IDKFZp564M1682, membrane-associated ring finger (C3HC4) 1, Membrane-associated RING finger protein 1, Membrane-associated RING-CH protein I, RING finger protein 171, RNF171FLJ20668 |
|---|
| Gene, Accession # | MARCH1, Gene ID: 55016, Accession: Q8TCQ1, SwissProt: Q8TCQ1 |
|---|
| Catalog # | NBP1-91637 |
|---|
| Price | |
|---|
| Order / More Info | MARCH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|