| Edit |   |
| Antigenic Specificity | SCRT2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SCRT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCRT2. This antibody reacts with human. The SCRT2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human SCRT2The immunogen for this antibody is SCRT2. Peptide sequence HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS. |
| Other Names | scratch homolog 2, zinc finger protein (Drosophila), transcriptional repressor scratch 2, ZNF898B |
| Gene, Accession # | SCRT2, Gene ID: 85508, Accession: NP_149120, SwissProt: NP_149120 |
| Catalog # | NBP1-79405 |
| Price | |
| Order / More Info | SCRT2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |