| Edit |   |
|---|
| Antigenic Specificity | SCRN2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCRN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCRN2. This antibody reacts with human. The SCRN2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SCRN2(secernin 2) The peptide sequence was selected from the N terminal of SCRN2. Peptide sequence MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT. |
|---|
| Other Names | secernin 2, secernin-2, Ses2 |
|---|
| Gene, Accession # | SCRN2, Gene ID: 90507, Accession: Q96FV2, SwissProt: Q96FV2 |
|---|
| Catalog # | NBP1-56896-20ul |
|---|
| Price | |
|---|
| Order / More Info | SCRN2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|