| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UNC93A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UNC93A Antibody from Novus Biologicals is a rabbit polyclonal antibody to UNC93A. This antibody reacts with human. The UNC93A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UNC93A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR |
|---|
| Other Names | dJ366N23.1, dJ366N23.1 (putative C. elegans UNC-93 (protein 1, C46F11.1) LIKE), dJ366N23.2, dJ366N23.2 (putative C. elegans UNC-93 (protein 1, C46F11.1) C-terminal LIKE), unc93 homolog A, unc-93 homolog A (C. elegans) |
|---|
| Gene, Accession # | UNC93A, Gene ID: 54346 |
|---|
| Catalog # | NBP1-90576 |
|---|
| Price | |
|---|
| Order / More Info | UNC93A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|