| Edit |   |
| Antigenic Specificity | UMODL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UMODL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UMODL1. This antibody reacts with human. The UMODL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human UMODL1. Peptide sequence EMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKVVLTECWATPSSN. |
| Other Names | uromodulin-like 1 |
| Gene, Accession # | UMODL1, Gene ID: 89766, Accession: NP_001004416, SwissProt: NP_001004416 |
| Catalog # | NBP1-80535 |
| Price | |
| Order / More Info | UMODL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |