| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ULK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ULK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ULK1. This antibody reacts with human. The ULK1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ULK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP |
|---|
| Other Names | ATG1, ATG1 autophagy related 1 homolog, ATG1A, EC 2.7.11, EC 2.7.11.1, FLJ38455, FLJ46475, KIAA0722, serine/threonine-protein kinase ULK1, UNC51, unc-51 (C. elegans)-like kinase 1, Unc51.1, Unc-51-like kinase 1, unc-51-like kinase 1 (C. elegans) |
|---|
| Gene, Accession # | ULK1, Gene ID: 8408 |
|---|
| Catalog # | NBP2-56576 |
|---|
| Price | |
|---|
| Order / More Info | ULK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|