| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TJP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TJP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TJP3. This antibody reacts with human. The TJP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TJP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS |
|---|
| Other Names | MGC119546, Tight junction protein 3, tight junction protein 3 (zona occludens 3), ZO-3, ZO3tight junction protein ZO-3, zona occludens 3, Zona occludens protein 3, Zonula occludens protein 3 |
|---|
| Gene, Accession # | TJP3, Gene ID: 27134, Accession: O95049, SwissProt: O95049 |
|---|
| Catalog # | NBP2-38696 |
|---|
| Price | |
|---|
| Order / More Info | TJP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|